PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C00703.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 264aa    MW: 29683.9 Da    PI: 9.3196
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C00703.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.41.2e-30959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien++ rqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  Pahal.C00703.2  9 KRIENNTSRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 59
                    79***********************************************95 PP

2K-box101.51.2e-33821758100
           K-box   8 s.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                       le + ++++qqe+akL+++i++Lq+++Rhl+G+++e+LslkeL+qLe++Lek+++kiR++K+ell ++i+++ k+e elq+++++Lr+k+ee
  Pahal.C00703.2  82 PlLELNAQQYYQQESAKLRNQIQMLQNTNRHLVGDSVENLSLKELKQLESRLEKGISKIRARKSELLSAEINYMVKRETELQNDHMNLRTKIEE 175
                     45677889************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.543161IPR002100Transcription factor, MADS-box
SMARTSM004327.5E-41160IPR002100Transcription factor, MADS-box
CDDcd002657.79E-45278No hitNo description
SuperFamilySSF554551.44E-32275IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.6E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-323859IPR002100Transcription factor, MADS-box
PfamPF014863.4E-2487173IPR002487Transcription factor, K-box
PROSITE profilePS5129714.98389179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048283Biological Processindeterminate inflorescence morphogenesis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MGRGRIEIKR IENNTSRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYSNN  60
SVKATIERYK KAHAVGSSSG APLLELNAQQ YYQQESAKLR NQIQMLQNTN RHLVGDSVEN  120
LSLKELKQLE SRLEKGISKI RARKSELLSA EINYMVKRET ELQNDHMNLR TKIEEGEQQL  180
QQVTVARSAA VAAASAELNP FFQMDTKCFF PAGPFAGLDM KCFFPGGLQM LEAHRQILTT  240
ELNLGYQLAP PSGDDGINNP HQF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-19169169Myocyte-specific enhancer factor 2B
1tqe_R2e-19169169Myocyte-specific enhancer factor 2B
1tqe_Q2e-19169169Myocyte-specific enhancer factor 2B
1tqe_P2e-19169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankZMU315220.0U31522.1 Zea Mays MADS box protein (ZmOV23) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960786.11e-180PREDICTED: MADS-box transcription factor 13-like
SwissprotQ2QW531e-126MAD13_ORYSJ; MADS-box transcription factor 13
TrEMBLK3Z8W11e-180K3Z8W1_SETIT; Uncharacterized protein
STRINGSi022981m1e-179(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.14e-81MIKC_MADS family protein